| Identification |
| HMDB Protein ID
| HMDBP11801 |
| Secondary Accession Numbers
| None |
| Name
| Katanin p60 ATPase-containing subunit A-like 1 |
| Synonyms
|
- Katanin p60 subunit A-like 1
- p60 katanin-like 1
|
| Gene Name
| KATNAL1 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Regulates microtubule dynamics in Sertoli cells, a process that is essential for spermiogenesis and male fertility. Severs microtubules in an ATP-dependent manner, promoting rapid reorganization of cellular microtubule arrays (By similarity).
|
| Pathways
|
Not Available
|
| Reactions
|
| Adenosine triphosphate + Water → ADP + Phosphate |
details
|
|
| GO Classification
|
| Cellular Component |
| cytoplasm |
| microtubule |
| Molecular Function |
| ATP binding |
| microtubule-severing ATPase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 13 |
| Locus
| 13q12.3 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 55391.805 |
| Theoretical pI
| 6.741 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|62177112|ref|NP_001014402.1| katanin p60 ATPase-containing subunit A-like 1 [Homo sapiens]
MNLAEICDNAKKGREYALLGNYDSSMVYYQGVMQQIQRHCQSVRDPAIKGKWQQVRQELL
EEYEQVKSIV
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9BW62 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:28361 |
| References |
| General References
| Not Available |