| Identification |
| HMDB Protein ID
| HMDBP11800 |
| Secondary Accession Numbers
| None |
| Name
| Histone acetyltransferase KAT6A |
| Synonyms
|
- MOZ, YBF2/SAS3, SAS2 and TIP60 protein 3
- Monocytic leukemia zinc finger protein
- Runt-related transcription factor-binding protein 2
- Zinc finger protein 220
- MYST-3
|
| Gene Name
| KAT6A |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Histone acetyltransferase that acetylates lysine residues in histone H3 and histone H4 (in vitro). Component of the MOZ/MORF complex which has a histone H3 acetyltransferase activity. May act as a transcriptional coactivator for RUNX1 and RUNX2.
|
| Pathways
|
Not Available
|
| Reactions
|
| Acetyl-CoA + [histone] → Coenzyme A + acetyl-[histone] |
details
|
|
| GO Classification
|
| Biological Process |
| nucleosome assembly |
| transcription, DNA-dependent |
| myeloid cell differentiation |
| negative regulation of transcription, DNA-dependent |
| positive regulation of transcription, DNA-dependent |
| embryonic hemopoiesis |
| DNA packaging |
| somatic stem cell maintenance |
| histone H3 acetylation |
| Cellular Component |
| nucleosome |
| MOZ/MORF histone acetyltransferase complex |
| Molecular Function |
| histone acetyltransferase activity |
| transcription factor binding |
| metal ion binding |
| DNA binding |
| transcription coactivator activity |
| zinc ion binding |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 8 |
| Locus
| 8p11 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 225026.115 |
| Theoretical pI
| 5.682 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|150378463|ref|NP_001092882.1| histone acetyltransferase KAT6A [Homo sapiens]
MVKLANPLYTEWILEAIKKVKKQKQRPSEERICNAVSSSHGLDRKTVLEQLELSVKDGTI
LKVSNKGLNS
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q92794 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:13013 |
| References |
| General References
| Not Available |