| Identification |
| HMDB Protein ID
| HMDBP11799 |
| Secondary Accession Numbers
| None |
| Name
| Adenylate kinase 8 |
| Synonyms
|
Not Available
|
| Gene Name
| AK8 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Adenylate kinase. Has highest activity toward AMP, and weaker activity toward dAMP, CMP and dCMP.
|
| Pathways
|
Not Available
|
| Reactions
|
| Adenosine triphosphate + Adenosine monophosphate → ADP |
details
|
|
| GO Classification
|
| Cellular Component |
| cytosol |
| Molecular Function |
| ATP binding |
| cytidylate kinase activity |
| adenylate kinase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 9 |
| Locus
| 9q34.13 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 54925.01 |
| Theoretical pI
| 6.147 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|22749187|ref|NP_689785.1| adenylate kinase 8 [Homo sapiens]
MDATIAPHRIPPEMPQYGEENHIFELMQNMLEQLLIHQPEDPIPFMIQHLHRDNDNVPRI
VILGPPASGK
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q96MA6 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:26526 |
| References |
| General References
| Not Available |