| Identification |
| HMDB Protein ID
| HMDBP11798 |
| Secondary Accession Numbers
| None |
| Name
| Adenylate kinase isoenzyme 6 |
| Synonyms
|
- ATP-AMP transphosphorylase 6
- Coilin-interacting nuclear ATPase protein
- hCINAP
|
| Gene Name
| TAF9 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Broad activity as an NMP kinase. AMP and dAMP are the preferred substrates of all tested NMPs, but CMP and dCMP are also good substrates. IMP can be phosphorylated, but to a much lesser extent. Adenylate and cytidylate can serve as phosphate acceptors.
|
| Pathways
|
- Basal transcription factors
- Ribosome biogenesis in eukaryotes
|
| Reactions
|
| Adenosine triphosphate + Adenosine monophosphate → ADP |
details
|
|
| GO Classification
|
| Cellular Component |
| Cajal body |
| Molecular Function |
| ATP binding |
| adenylate kinase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 5 |
| Locus
| 5q11.2-q13.1 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 19804.97 |
| Theoretical pI
| 4.735 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|62865612|ref|NP_001015891.1| adenylate kinase isoenzyme 6 isoform c [Homo sapiens]
MCHRKPGTPGVGKTTLGKELASKSGLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVD
ELDNQMREGG
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9Y3D8 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:11542 |
| References |
| General References
| Not Available |