| Identification |
| HMDB Protein ID
| HMDBP11784 |
| Secondary Accession Numbers
| None |
| Name
| Probable 4-hydroxy-2-oxoglutarate aldolase, mitochondrial |
| Synonyms
|
- Dihydrodipicolinate synthase-like
- Probable 2-keto-4-hydroxyglutarate aldolase
- Protein 569272
- DHDPS-like protein
- Probable KHG-aldolase
|
| Gene Name
| HOGA1 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Catalyzes the final step in the metabolic pathway of hydroxyproline (Probable).
|
| Pathways
|
Not Available
|
| Reactions
|
| 4-Hydroxy-2-oxoglutaric acid → Pyruvic acid + Glyoxylic acid |
details
|
|
| GO Classification
|
| Biological Process |
| 4-hydroxyproline catabolic process |
| glyoxylate catabolic process |
| oxalate metabolic process |
| pyruvate biosynthetic process |
| Cellular Component |
| mitochondrion |
| Molecular Function |
| protein homodimerization activity |
| 4-hydroxy-2-oxoglutarate aldolase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 10 |
| Locus
| 10q24.2 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 17953.475 |
| Theoretical pI
| 7.723 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|197927274|ref|NP_001128142.1| probable 4-hydroxy-2-oxoglutarate aldolase, mitochondrial isoform 2 [Homo sapiens]
MLGPQVWSSVRQGLSRSLSRNVGVWASGEGKKVDIAGIYPPVTTPFTATAEVDYGKLEEN
LHKLGTFPFR
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q86XE5 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:25155 |
| References |
| General References
| Not Available |