| Identification |
| HMDB Protein ID
| HMDBP11782 |
| Secondary Accession Numbers
| None |
| Name
| Heparan-alpha-glucosaminide N-acetyltransferase |
| Synonyms
|
- Transmembrane protein 76
|
| Gene Name
| HGSNAT |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Lysosomal acetyltransferase that acetylates the non-reducing terminal alpha-glucosamine residue of intralysosomal heparin or heparan sulfate, converting it into a substrate for luminal alpha-N-acetyl glucosaminidase.
|
| Pathways
|
- Glycosaminoglycan degradation
- Lysosome
|
| Reactions
|
| Acetyl-CoA + heparan sulfate alpha-D-glucosaminide → Coenzyme A + heparan sulfate N-acetyl-alpha-D-glucosaminide |
details
|
| Acetyl-CoA + → Coenzyme A + |
details
|
|
| GO Classification
|
| Biological Process |
| small molecule metabolic process |
| carbohydrate metabolic process |
| glycosaminoglycan catabolic process |
| lysosomal transport |
| protein oligomerization |
| Cellular Component |
| integral to membrane |
| lysosomal membrane |
| Molecular Function |
| heparan-alpha-glucosaminide N-acetyltransferase activity |
| transferase activity, transferring acyl groups |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 8 |
| Locus
| 8p11.1 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 70495.57 |
| Theoretical pI
| 8.003 |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|150378452|ref|NP_689632.2| heparan-alpha-glucosaminide N-acetyltransferase precursor [Homo sapiens]
MSGAGRALAALLLAASVLSAALLAPGGSSGRDAQAAPPRDLDKKRHAELKMDQALLLIHN
ELLWTNLTVY
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q68CP4 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:26527 |
| References |
| General References
| Not Available |