| Identification |
| HMDB Protein ID
| HMDBP11771 |
| Secondary Accession Numbers
| None |
| Name
| Glucoside xylosyltransferase 1 |
| Synonyms
|
- Glycosyltransferase 8 domain-containing protein 3
|
| Gene Name
| GXYLT1 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Glycosyltransferase which elongates the O-linked glucose attached to EGF-like repeats in the extracellular domain of Notch proteins by catalyzing the addition of xylose.
|
| Pathways
|
- Other types of O-glycan biosynthesis
|
| Reactions
|
| UDP-D-Xylose + beta-D-glucosyl-R → Uridine 5'-diphosphate + alpha-D-xylose-(1->3)-beta-D-glucosyl-R |
details
|
|
| GO Classification
|
| Biological Process |
| chondroitin sulfate metabolic process |
| O-glycan processing |
| Cellular Component |
| integral to membrane |
| Golgi membrane |
| Molecular Function |
| UDP-xylosyltransferase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 12 |
| Locus
| 12q12 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 46799.87 |
| Theoretical pI
| 8.955 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|153791276|ref|NP_001093120.1| glucoside xylosyltransferase 1 isoform 2 [Homo sapiens]
MRRYLRVVVLCVACGFCSLLYAFSQLAVSLEEGTGGGGGKPQAAVASWLAGGGRGAVRGA
GVAGPAAHPG
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q4G148 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:27482 |
| References |
| General References
| Not Available |