Hmdb loader
Identification
HMDB Protein ID HMDBP11770
Secondary Accession Numbers None
Name Solute carrier family 2, facilitated glucose transporter member 9
Synonyms
  1. Glucose transporter type 9
  2. GLUT-9
Gene Name SLC2A9
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Transport urate and fructose. May have a role in the urate reabsorption by proximal tubules. Also transports glucose at low rate.
Pathways Not Available
Reactions Not Available
GO Classification
Biological Process
glucose transport
urate metabolic process
Cellular Component
integral to membrane
plasma membrane
integral to plasma membrane
nuclear envelope
Molecular Function
sugar:hydrogen symporter activity
glucose transmembrane transporter activity
Cellular Location Not Available
Gene Properties
Chromosome Location 4
Locus 4p16.1
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 55720.81
Theoretical pI 8.508
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|47933389|ref|NP_001001290.1| solute carrier family 2, facilitated glucose transporter member 9 isoform 2 [Homo sapiens]
MKLSKKDRGEDEESDSAKKKLDWSCSLLVASLAGAFGSSFLYGYNLSVVNAPTPYIKAFY
NESWERRHGR
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9NRM0
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:13446
References
General References Not Available