| Identification |
| HMDB Protein ID
| HMDBP11769 |
| Secondary Accession Numbers
| None |
| Name
| Solute carrier family 2, facilitated glucose transporter member 8 |
| Synonyms
|
- Glucose transporter type 8
- Glucose transporter type X1
- GLUT-8
|
| Gene Name
| SLC2A8 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Insulin-regulated facilitative glucose transporter. Binds cytochalasin B in a glucose-inhibitable manner. Seems to be a dual-specific sugar transporter as it is inhibitable by fructose (By similarity).
|
| Pathways
|
Not Available
|
| Reactions
| Not Available |
| GO Classification
|
| Biological Process |
| response to hypoxia |
| carbohydrate metabolic process |
| male meiosis I |
| insulin receptor signaling pathway |
| Cellular Component |
| integral to plasma membrane |
| intracellular membrane-bounded organelle |
| cytoplasmic vesicle membrane |
| synaptic vesicle |
| Molecular Function |
| glucose binding |
| glucose transmembrane transporter activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 9 |
| Locus
| 9q33.3 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 50818.54 |
| Theoretical pI
| 7.607 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|21361449|ref|NP_055395.2| solute carrier family 2, facilitated glucose transporter member 8 isoform 1 [Homo sapiens]
MTPEDPEETQPLLGPPGGSAPRGRRVFLAAFAAALGPLSFGFALGYSSPAIPSLQRAAPP
APRLDDAAAS
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9NY64 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:13812 |
| References |
| General References
| Not Available |