| Identification |
| HMDB Protein ID
| HMDBP11768 |
| Secondary Accession Numbers
| None |
| Name
| Solute carrier family 2, facilitated glucose transporter member 7 |
| Synonyms
|
- Glucose transporter type 7
- GLUT-7
|
| Gene Name
| SLC2A7 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| High-affinity transporter for glucose and fructose Does not transport galactose, 2-deoxy-d-glucose and xylose.
|
| Pathways
|
Not Available
|
| Reactions
| Not Available |
| GO Classification
|
| Biological Process |
| transmembrane transport |
| carbohydrate transport |
| Cellular Component |
| integral to membrane |
| plasma membrane |
| Molecular Function |
| substrate-specific transmembrane transporter activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 1 |
| Locus
| 1p36.2 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 55726.915 |
| Theoretical pI
| 8.41 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|134053883|ref|NP_997303.2| solute carrier family 2, facilitated glucose transporter member 7 [Homo sapiens]
MENKEAGTPPPIPSREGRLQPTLLLATLSAAFGSAFQYGYNLSVVNTPHKVFKSFYNETY
FERHATFMDG
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q6PXP3 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:13445 |
| References |
| General References
| Not Available |