| Identification |
| HMDB Protein ID
| HMDBP11766 |
| Secondary Accession Numbers
| None |
| Name
| Solute carrier family 2, facilitated glucose transporter member 5 |
| Synonyms
|
- Fructose transporter
- Glucose transporter type 5, small intestine
- GLUT-5
|
| Gene Name
| SLC2A5 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Cytochalasin B-sensitive carrier. Seems to function primarily as a fructose transporter.
|
| Pathways
|
- Carbohydrate digestion and absorption
|
| Reactions
| Not Available |
| GO Classification
|
| Biological Process |
| small molecule metabolic process |
| carbohydrate metabolic process |
| Cellular Component |
| integral to membrane |
| plasma membrane |
| Molecular Function |
| glucose transmembrane transporter activity |
| fructose transmembrane transporter activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 1 |
| Locus
| 1p36.2 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 26518.715 |
| Theoretical pI
| 7.461 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|207447703|ref|NP_001129057.1| solute carrier family 2, facilitated glucose transporter member 5 isoform 2 [Homo sapiens]
MEQQDQSMKEGRLTLVLALATLIAAFGSSFQYGYNVAAVNSPALLMQQFYNETYYGRTGE
FMEDFPLTLL
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| P22732 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:11010 |
| References |
| General References
| Not Available |