| Identification |
|---|
| HMDB Protein ID
| HMDBP11765 |
| Secondary Accession Numbers
| None |
| Name
| Solute carrier family 2, facilitated glucose transporter member 4 |
| Synonyms
|
- Glucose transporter type 4, insulin-responsive
- GLUT-4
|
| Gene Name
| SLC2A4 |
| Protein Type
| Unknown |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Insulin-regulated facilitative glucose transporter.
|
| Pathways
|
- Adipocytokine signaling pathway
- Glucose-Alanine Cycle
- Insulin signaling pathway
- Insulin Signalling
- Type II diabetes mellitus
|
| Reactions
| Not Available |
| GO Classification
|
| Biological Process |
| glucose import |
| response to ethanol |
| cellular response to insulin stimulus |
| brown fat cell differentiation |
| glucose homeostasis |
| carbohydrate metabolic process |
| small molecule metabolic process |
| Cellular Component |
| vesicle membrane |
| multivesicular body |
| insulin-responsive compartment |
| coated pit |
| clathrin-coated vesicle |
| trans-Golgi network transport vesicle |
| sarcolemma |
| external side of plasma membrane |
| perinuclear region of cytoplasm |
| integral to plasma membrane |
| extracellular vesicular exosome |
| Molecular Function |
| glucose transmembrane transporter activity |
| D-glucose transmembrane transporter activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 17 |
| Locus
| 17p13 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 54786.79 |
| Theoretical pI
| 6.931 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|4507011|ref|NP_001033.1| solute carrier family 2, facilitated glucose transporter member 4 [Homo sapiens]
MPSGFQQIGSEDGEPPQQRVTGTLVLAVFSAVLGSLQFGYNIGVINAPQKVIEQSYNETW
LGRQGPEGPS
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| P14672 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:11009 |
| References |
|---|
| General References
| Not Available |
