Hmdb loader
Identification
HMDB Protein ID HMDBP11764
Secondary Accession Numbers None
Name Solute carrier family 2, facilitated glucose transporter member 3
Synonyms
  1. Glucose transporter type 3, brain
  2. GLUT-3
Gene Name SLC2A3
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Facilitative glucose transporter. Probably a neuronal glucose transporter.
Pathways Not Available
Reactions Not Available
GO Classification
Biological Process
L-ascorbic acid metabolic process
Cellular Component
integral to membrane
plasma membrane
Molecular Function
glucose transmembrane transporter activity
Cellular Location Not Available
Gene Properties
Chromosome Location 12
Locus 12p13.3
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 53923.785
Theoretical pI 7.198
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|5902090|ref|NP_008862.1| solute carrier family 2, facilitated glucose transporter member 3 [Homo sapiens]
MGTQKVTPALIFAITVATIGSFQFGYNTGVINAPEKIIKEFINKTLTDKGNAPPSEVLLT
SLWSLSVAIF
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P11169
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:11007
References
General References Not Available