| Identification |
| HMDB Protein ID
| HMDBP11762 |
| Secondary Accession Numbers
| None |
| Name
| Solute carrier family 2, facilitated glucose transporter member 12 |
| Synonyms
|
- Glucose transporter type 12
- GLUT-12
|
| Gene Name
| SLC2A12 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Facilitative glucose transporter (By similarity).
|
| Pathways
|
Not Available
|
| Reactions
| Not Available |
| GO Classification
|
| Biological Process |
| transmembrane transport |
| carbohydrate transport |
| Cellular Component |
| integral to membrane |
| plasma membrane |
| endomembrane system |
| perinuclear region of cytoplasm |
| Molecular Function |
| substrate-specific transmembrane transporter activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 6 |
| Locus
| 6q23.2 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 66965.7 |
| Theoretical pI
| 8.363 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|21553331|ref|NP_660159.1| solute carrier family 2, facilitated glucose transporter member 12 [Homo sapiens]
MVPVENTEGPSLLNQKGTAVETEGSGSRHPPWARGCGMFTFLSSVTAAVSGLLVGYELGI
ISGALLQIKT
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q8TD20 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:18067 |
| References |
| General References
| Not Available |