Hmdb loader
Identification
HMDB Protein ID HMDBP11749
Secondary Accession Numbers None
Name Poly(A) RNA polymerase GLD2
Synonyms
  1. hGLD-2
  2. PAP-associated domain-containing protein 4
  3. Terminal uridylyltransferase 2
  4. TUTase 2
Gene Name PAPD4
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Cytoplasmic poly(A) RNA polymerase that adds successive AMP monomers to the 3'-end of specific RNAs, forming a poly(A) tail. In contrast to the canonical nuclear poly(A) RNA polymerase, it only adds poly(A) to selected cytoplasmic mRNAs. Does not play a role in replication-dependent histone mRNA degradation.
Pathways Not Available
Reactions
Adenosine triphosphate + RNA(n) → Pyrophosphate + RNA(n+1) details
GO Classification
Biological Process
mRNA processing
histone mRNA catabolic process
RNA polyadenylation
Cellular Component
cytoplasm
nuclear RNA-directed RNA polymerase complex
Molecular Function
metal ion binding
ATP binding
polynucleotide adenylyltransferase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 5
Locus 5q14.1
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 56027.175
Theoretical pI 9.375
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|167555097|ref|NP_001107865.1| poly(A) RNA polymerase GLD2 [Homo sapiens]
MFPNSILGRPPFTPNHQQHNNFFTLSPTVYSHQQLIDAQFNFQNADLSRAVSLQQLTYGN
VSPIQTSASP
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q6PIY7
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:26776
References
General References Not Available