| Identification |
| HMDB Protein ID
| HMDBP11745 |
| Secondary Accession Numbers
| None |
| Name
| GDP-D-glucose phosphorylase 1 |
| Synonyms
|
Not Available
|
| Gene Name
| GDPGP1 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Specific and highly efficient GDP-D-glucose phosphorylase regulating the levels of GDP-D-glucose in cells.
|
| Pathways
|
Not Available
|
| Reactions
|
| GDP-glucose + Phosphate → Glucose 1-phosphate + Guanosine diphosphate |
details
|
|
| GO Classification
|
| Biological Process |
| glucose metabolic process |
| Cellular Component |
| cytoplasm |
| Molecular Function |
| nucleotide binding |
| hydrolase activity |
| nucleotidyltransferase activity |
| GDP-D-glucose phosphorylase activity |
| guanyl-nucleotide exchange factor activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 15 |
| Locus
| 15q26.1 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 42362.06 |
| Theoretical pI
| 6.469 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|116642895|ref|NP_001013679.2| GDP-D-glucose phosphorylase 1 [Homo sapiens]
MALPHDSNETSYLLPPNNEDWGRQTIPDFVYGQKDLMAEGIQWPRNAPGIPDALPQSPFD
AALCSAWKQR
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q6ZNW5 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:34360 |
| References |
| General References
| Not Available |