| Identification |
| HMDB Protein ID
| HMDBP11744 |
| Secondary Accession Numbers
| None |
| Name
| Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 4 |
| Synonyms
|
- Core 2-branching enzyme 3
- Core2-GlcNAc-transferase 3
- C2GnT3
|
| Gene Name
| GCNT4 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Glycosyltransferase that mediates core 2 O-glycan branching, an important step in mucin-type biosynthesis. Does not have core 4 O-glycan or I-branching enzyme activity.
|
| Pathways
|
- Mucin type O-glycan biosynthesis
- protein glycosylation
|
| Reactions
|
| Uridine diphosphate-N-acetylglucosamine + beta-D-galactosyl-1,3-N-acetyl-D-galactosaminyl-R → Uridine 5'-diphosphate + beta-D-galactosyl-1,3-(N-acetyl-beta-D-glucosaminyl-1,6)-N-acetyl-D-galactosaminyl-R |
details
|
| UDP-N-acetyl-D-glucosamine + T antigen → UDP + |
details
|
|
| GO Classification
|
| Biological Process |
| post-translational protein modification |
| O-glycan processing |
| thyroid hormone metabolic process |
| kidney morphogenesis |
| tissue morphogenesis |
| homeostasis of number of cells |
| inter-male aggressive behavior |
| Cellular Component |
| integral to membrane |
| Golgi membrane |
| Molecular Function |
| beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase activity |
| N-acetyllactosaminide beta-1,6-N-acetylglucosaminyltransferase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 5 |
| Locus
| 5q12 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 53051.69 |
| Theoretical pI
| 8.245 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|7706127|ref|NP_057675.1| beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 4 [Homo sapiens]
MKIFKCYFKHTLQQKVFILFLTLWLLSLLKLLNVRRLFPQKDIYLVEYSLSTSPFVRNRY
THVKDEVRYE
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9P109 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:17973 |
| References |
| General References
| Not Available |