| Identification |
| HMDB Protein ID
| HMDBP11736 |
| Secondary Accession Numbers
| None |
| Name
| F-box only protein 18 |
| Synonyms
|
- F-box DNA helicase 1
|
| Gene Name
| FBXO18 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| DNA-dependent ATPase. Unwinds double-stranded DNA in a 3' to 5' direction.
Probably recognizes and binds to some phosphorylated proteins and promotes their ubiquitination and degradation.
|
| Pathways
|
Not Available
|
| Reactions
|
| Adenosine triphosphate + Water → ADP + Phosphate |
details
|
|
| GO Classification
|
| Cellular Component |
| nucleus |
| Molecular Function |
| ATP binding |
| DNA binding |
| ATP-dependent DNA helicase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 10 |
| Locus
| 10p15.1 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 110906.485 |
| Theoretical pI
| 7.408 |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|386268044|ref|NP_001245381.1| F-box only protein 18 isoform 3 [Homo sapiens]
MAKSNSVGQDSCQDSEGDMIFPAESSCALPQEGSAGPGSPGSAPPSRKRSWSSEEESNQA
TGTSRWDGVS
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q8NFZ0 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:13620 |
| References |
| General References
| Not Available |