| Identification |
| HMDB Protein ID
| HMDBP11735 |
| Secondary Accession Numbers
| None |
| Name
| Fanconi anemia group M protein |
| Synonyms
|
- Protein FACM
- ATP-dependent RNA helicase FANCM
- Fanconi anemia-associated polypeptide of 250 kDa
- Protein Hef ortholog
- FAAP250
|
| Gene Name
| FANCM |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| ATPase required for FANCD2 ubiquitination, a key reaction in DNA repair. Binds to ssDNA but not to dsDNA. Recruited to forks stalled by DNA interstrand cross-links, and required for cellular resistance to such lesions.
|
| Pathways
|
|
| Reactions
|
| Adenosine triphosphate + Water → ADP + Phosphate |
details
|
|
| GO Classification
|
| Biological Process |
| DNA repair |
| replication fork processing |
| nucleic acid phosphodiester bond hydrolysis |
| resolution of meiotic recombination intermediates |
| Cellular Component |
| FANCM-MHF complex |
| Fanconi anaemia nuclear complex |
| Molecular Function |
| ATP binding |
| chromatin binding |
| DNA binding |
| ATP-dependent helicase activity |
| nuclease activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 14 |
| Locus
| 14q21.2 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 232189.375 |
| Theoretical pI
| 6.108 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|74959747|ref|NP_065988.1| Fanconi anemia group M protein [Homo sapiens]
MSGRQRTLFQTWGSSISRSSGTPGCSSGTERPQSPGSSKAPLPAAAEAQLESDDDVLLVA
AYEAERQLCL
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q8IYD8 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:23168 |
| References |
| General References
| Not Available |