| Identification |
| HMDB Protein ID
| HMDBP11734 |
| Secondary Accession Numbers
| None |
| Name
| Fanconi anemia group J protein |
| Synonyms
|
- Protein FACJ
- ATP-dependent RNA helicase BRIP1
- BRCA1-associated C-terminal helicase 1
- BRCA1-interacting protein C-terminal helicase 1
- BRCA1-interacting protein 1
|
| Gene Name
| BRIP1 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| DNA-dependent ATPase and 5' to 3' DNA helicase required for the maintenance of chromosomal stability. Acts late in the Fanconi anemia pathway, after FANCD2 ubiquitination. Involved in the repair of DNA double-strand breaks by homologous recombination in a manner that depends on its association with BRCA1.
|
| Pathways
|
|
| Reactions
|
| Adenosine triphosphate + Water → ADP + Phosphate |
details
|
|
| GO Classification
|
| Biological Process |
| regulation of transcription from RNA polymerase II promoter |
| DNA damage checkpoint |
| double-strand break repair |
| Cellular Component |
| cytoplasm |
| nuclear membrane |
| Molecular Function |
| metal ion binding |
| ATP binding |
| 4 iron, 4 sulfur cluster binding |
| DNA binding |
| ATP-dependent DNA helicase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 17 |
| Locus
| 17q22.2 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 140866.21 |
| Theoretical pI
| 6.917 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|301897118|ref|NP_114432.2| Fanconi anemia group J protein [Homo sapiens]
MSSMWSEYTIGGVKIYFPYKAYPSQLAMMNSILRGLNSKQHCLLESPTGSGKSLALLCSA
LAWQQSLSGK
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9BX63 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:20473 |
| References |
| General References
| Not Available |