| Identification |
|---|
| HMDB Protein ID
| HMDBP11733 |
| Secondary Accession Numbers
| None |
| Name
| TFIIH basal transcription factor complex helicase XPB subunit |
| Synonyms
|
- Basic transcription factor 2 89 kDa subunit
- DNA excision repair protein ERCC-3
- DNA repair protein complementing XP-B cells
- TFIIH basal transcription factor complex 89 kDa subunit
- Xeroderma pigmentosum group B-complementing protein
- BTF2 p89
- TFIIH 89 kDa subunit
- TFIIH p89
|
| Gene Name
| ERCC3 |
| Protein Type
| Unknown |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| ATP-dependent 3'-5' DNA helicase, component of the core-TFIIH basal transcription factor, involved in nucleotide excision repair (NER) of DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II. Acts by opening DNA either around the RNA transcription start site or the DNA damage.
|
| Pathways
|
- Basal transcription factors
- Nucleotide excision repair
|
| Reactions
|
| Adenosine triphosphate + Water → ADP + Phosphate |
details
|
|
| GO Classification
|
| Biological Process |
| transcription-coupled nucleotide-excision repair |
| nucleotide-excision repair, DNA duplex unwinding |
| DNA topological change |
| transcription initiation from RNA polymerase I promoter |
| transcription elongation from RNA polymerase I promoter |
| termination of RNA polymerase I transcription |
| nucleotide-excision repair, DNA incision |
| nucleotide-excision repair, DNA damage removal |
| hair cell differentiation |
| cell cycle checkpoint |
| 7-methylguanosine mRNA capping |
| response to UV |
| response to oxidative stress |
| protein localization |
| positive regulation of viral transcription |
| positive regulation of transcription from RNA polymerase II promoter |
| transcription initiation from RNA polymerase II promoter |
| virus-host interaction |
| UV protection |
| transcription elongation from RNA polymerase II promoter |
| induction of apoptosis |
| response to hypoxia |
| viral reproduction |
| Cellular Component |
| holo TFIIH complex |
| SSL2-core TFIIH complex |
| Molecular Function |
| ATPase activity |
| ATP binding |
| RNA polymerase II carboxy-terminal domain kinase activity |
| dATP binding |
| 3'-5' DNA helicase activity |
| GTP binding |
| peptide binding |
| ATP-dependent DNA helicase activity |
| damaged DNA binding |
| transcription factor binding |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 2 |
| Locus
| 2q21 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 89276.985 |
| Theoretical pI
| 7.227 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|4557563|ref|NP_000113.1| TFIIH basal transcription factor complex helicase XPB subunit [Homo sapiens]
MGKRDRADRDKKKSRKRHYEDEEDDEEDAPGNDPQEAVPSAAGKQVDESGTKVDEYGAKD
YRLQMPLKDD
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| P19447 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:3435 |
| References |
|---|
| General References
| Not Available |
