| Identification |
| HMDB Protein ID
| HMDBP11732 |
| Secondary Accession Numbers
| None |
| Name
| DNA excision repair protein ERCC-6-like |
| Synonyms
|
- ATP-dependent helicase ERCC6-like
- PLK1-interacting checkpoint helicase
- Tumor antigen BJ-HCC-15
|
| Gene Name
| ERCC6L |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| DNA helicase that acts as an essential component of the spindle assembly checkpoint. Contributes to the mitotic checkpoint by recruiting MAD2 to kinetochores and monitoring tension on centromeric chromatin. Acts as a tension sensor that associates with catenated DNA which is stretched under tension until it is resolved during anaphase.
|
| Pathways
|
Not Available
|
| Reactions
|
| Adenosine triphosphate + Water → ADP + Phosphate |
details
|
|
| GO Classification
|
| Biological Process |
| cell division |
| mitotic prometaphase |
| Cellular Component |
| cytosol |
| condensed chromosome kinetochore |
| Molecular Function |
| ATP binding |
| DNA binding |
| helicase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| X |
| Locus
| Xq13.1 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 141101.715 |
| Theoretical pI
| 5.309 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|58331268|ref|NP_060139.2| DNA excision repair protein ERCC-6-like [Homo sapiens]
MEASRRFPEAEALSPEQAAHYLRYVKEAKEATKNGDLEEAFKLFNLAKDIFPNEKVLSRI
QKIQEALEEL
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q2NKX8 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:20794 |
| References |
| General References
| Not Available |