| Identification |
| HMDB Protein ID
| HMDBP11730 |
| Secondary Accession Numbers
| None |
| Name
| Elongation of very long chain fatty acids protein 7 |
| Synonyms
|
- 3-keto acyl-CoA synthase ELOVL7
- ELOVL fatty acid elongase 7
- Very-long-chain 3-oxoacyl-CoA synthase 7
- ELOVL FA elongase 7
|
| Gene Name
| ELOVL7 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Condensing enzyme that catalyzes the synthesis of saturated and polyunsaturated very long chain fatty acids. Highest activity toward C18 acyl-CoAs, especially C18:3(n-3) acyl-CoAs and C18:3(n-6)-CoAs. Also active toward C20:4-, C18:0-, C18:1-, C18:2- and C16:0-CoAs, and weakly toward C20:0-CoA. Little or no activity toward C22:0-, C24:0-, or C26:0-CoAs.
|
| Pathways
|
|
| Reactions
|
| A very-long-chain acyl-CoA + Malonyl-CoA → Coenzyme A + a very-long-chain 3-oxoacyl-CoA + CO(2) |
details
|
| Malonyl-CoA + Acyl-CoA → 3-Oxoacyl-CoA + Coenzyme A + Carbon dioxide |
details
|
|
| GO Classification
|
| Biological Process |
| long-chain fatty-acyl-CoA biosynthetic process |
| triglyceride biosynthetic process |
| fatty acid elongation, saturated fatty acid |
| very long-chain fatty acid biosynthetic process |
| fatty acid elongation, polyunsaturated fatty acid |
| Cellular Component |
| integral to membrane |
| endoplasmic reticulum membrane |
| Molecular Function |
| transferase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 5 |
| Locus
| 5q12.1 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 33356.06 |
| Theoretical pI
| 9.266 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|157388949|ref|NP_001098028.1| elongation of very long chain fatty acids protein 7 [Homo sapiens]
MAFSDLTSRTVHLYDNWIKDADPRVEDWLLMSSPLPQTILLGFYVYFVTSLGPKLMENRK
PFELKKAMIT
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| A1L3X0 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:26292 |
| References |
| General References
| Not Available |