Hmdb loader
Identification
HMDB Protein ID HMDBP11728
Secondary Accession Numbers None
Name Elongation of very long chain fatty acids protein 5
Synonyms
  1. 3-keto acyl-CoA synthase ELOVL5
  2. ELOVL fatty acid elongase 5
  3. Fatty acid elongase 1
  4. Very-long-chain 3-oxoacyl-CoA synthase 5
  5. ELOVL FA elongase 5
  6. hELO1
Gene Name ELOVL5
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Condensing enzyme that catalyzes the synthesis of monounsaturated and of polyunsaturated very long chain fatty acids Acts specifically toward polyunsaturated acyl-CoA with the higher activity toward C18:3(n-6) acyl-CoA.
Pathways
  • alpha-Linolenic acid metabolism
  • Biosynthesis of unsaturated fatty acids
  • Fatty acid elongation
Reactions
A very-long-chain acyl-CoA + Malonyl-CoA → Coenzyme A + a very-long-chain 3-oxoacyl-CoA + CO(2) details
Malonyl-CoA + Acyl-CoA → 3-Oxoacyl-CoA + Coenzyme A + Carbon dioxide details
GO Classification
Biological Process
long-chain fatty-acyl-CoA biosynthetic process
triglyceride biosynthetic process
alpha-linolenic acid metabolic process
linoleic acid metabolic process
fatty acid elongation, monounsaturated fatty acid
very long-chain fatty acid biosynthetic process
fatty acid elongation, polyunsaturated fatty acid
Cellular Component
integral to membrane
endoplasmic reticulum membrane
Molecular Function
fatty acid elongase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 6
Locus 6p21.1-p12.1
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 38402.505
Theoretical pI 9.533
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|338827646|ref|NP_001229757.1| elongation of very long chain fatty acids protein 5 isoform 2 [Homo sapiens]
MEHFDASLSTYFKALLGPRDTRVKGWFLLDNYIPTFICSVIYLLIVWLGPKYMRNKQPFS
CRGILVVYNL
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9NYP7
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:21308
References
General References Not Available