| Identification |
| HMDB Protein ID
| HMDBP11724 |
| Secondary Accession Numbers
| None |
| Name
| ATP-dependent RNA helicase DDX39A |
| Synonyms
|
- DEAD box protein 39
- Nuclear RNA helicase URH49
|
| Gene Name
| DDX39A |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Involved in pre-mRNA splicing. Required for the export of mRNA out of the nucleus.
|
| Pathways
|
Not Available
|
| Reactions
|
| Adenosine triphosphate + Water → ADP + Phosphate |
details
|
|
| GO Classification
|
| Biological Process |
| mRNA export from nucleus |
| mRNA splicing, via spliceosome |
| Cellular Component |
| cytoplasm |
| nucleus |
| Molecular Function |
| ATP binding |
| nucleic acid binding |
| ATP-dependent helicase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 19 |
| Locus
| 19p13.12 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 49129.15 |
| Theoretical pI
| 5.676 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|21040371|ref|NP_005795.2| ATP-dependent RNA helicase DDX39A [Homo sapiens]
MAEQDVENDLLDYDEEEEPQAPQESTPAPPKKDIKGSYVSIHSSGFRDFLLKPELLRAIV
DCGFEHPSEV
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| O00148 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:17821 |
| References |
| General References
| Not Available |