| Identification |
| HMDB Protein ID
| HMDBP11723 |
| Secondary Accession Numbers
| None |
| Name
| Dual specificity protein phosphatase 26 |
| Synonyms
|
- Dual specificity phosphatase SKRP3
- Low-molecular-mass dual-specificity phosphatase 4
- Mitogen-activated protein kinase phosphatase 8
- Novel amplified gene in thyroid anaplastic cancer
- DSP-4
- LDP-4
- MAP kinase phosphatase 8
- MKP-8
|
| Gene Name
| DUSP26 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Inactivates MAPK1 and MAPK3 which leads to dephosphorylation of heat shock factor protein 4 and a reduction in its DNA-binding activity. Inhibits MAP kinase p38 by dephosphorylating it and inhibits p38-mediated apoptosis in anaplastic thyroid cancer cells. Can also induce activation of MAP kinase p38 and c-Jun N-terminal kinase (JNK).
|
| Pathways
|
Not Available
|
| Reactions
|
| Protein tyrosine phosphate + Water → protein tyrosine + Phosphate |
details
|
| A phosphoprotein + Water → a protein + Phosphate |
details
|
|
| GO Classification
|
| Biological Process |
| peptidyl-tyrosine dephosphorylation |
| Cellular Component |
| mitochondrion |
| nucleus |
| Golgi apparatus |
| Molecular Function |
| protein tyrosine phosphatase activity |
| protein tyrosine/serine/threonine phosphatase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 8 |
| Locus
| 8p12 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 23945.38 |
| Theoretical pI
| 9.607 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|13128968|ref|NP_076930.1| dual specificity protein phosphatase 26 [Homo sapiens]
MCPGNWLWASMTFMARFSRSSSRSPVRTRGTLEEMPTVQHPFLNVFELERLLYTGKTACN
HADEVWPGLY
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9BV47 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:28161 |
| References |
| General References
| Not Available |