| Identification |
| HMDB Protein ID
| HMDBP11721 |
| Secondary Accession Numbers
| None |
| Name
| Dual specificity protein phosphatase 22 |
| Synonyms
|
- JNK-stimulatory phosphatase-1
- Low molecular weight dual specificity phosphatase 2
- Mitogen-activated protein kinase phosphatase x
- JSP-1
- LMW-DSP2
- MAP kinase phosphatase x
- MKP-x
|
| Gene Name
| DUSP22 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Activates the Jnk signaling pathway. Dephosphorylates and deactivates p38 and stress-activated protein kinase/c-Jun N-terminal kinase (SAPK/JNK) (By similarity).
|
| Pathways
|
|
| Reactions
|
| Protein tyrosine phosphate + Water → protein tyrosine + Phosphate |
details
|
| A phosphoprotein + Water → a protein + Phosphate |
details
|
|
| GO Classification
|
| Biological Process |
| multicellular organismal development |
| regulation of cell proliferation |
| cell proliferation |
| apoptotic process |
| negative regulation of transcription from RNA polymerase II promoter |
| peptidyl-tyrosine dephosphorylation |
| inactivation of MAPK activity |
| positive regulation of JNK cascade |
| transforming growth factor beta receptor signaling pathway |
| Cellular Component |
| cytoplasm |
| nucleus |
| Molecular Function |
| protein tyrosine phosphatase activity |
| protein tyrosine/serine/threonine phosphatase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 6 |
| Locus
| 6p25.3 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 20909.845 |
| Theoretical pI
| 8.105 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|9910432|ref|NP_064570.1| dual specificity protein phosphatase 22 [Homo sapiens]
MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPS
QNLTRHFKES
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9NRW4 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:16077 |
| References |
| General References
| Not Available |