| Identification |
| HMDB Protein ID
| HMDBP11718 |
| Secondary Accession Numbers
| None |
| Name
| Decaprenyl-diphosphate synthase subunit 1 |
| Synonyms
|
- All-trans-decaprenyl-diphosphate synthase subunit 1
- Decaprenyl pyrophosphate synthase subunit 1
- Trans-prenyltransferase 1
- TPT 1
|
| Gene Name
| PDSS1 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Supplies decaprenyl diphosphate, the precursor for the side chain of the isoprenoid quinones ubiquinone-10.
|
| Pathways
|
- Terpenoid backbone biosynthesis
- ubiquinone biosynthesis
|
| Reactions
|
| Farnesyl pyrophosphate + Isopentenyl pyrophosphate → Pyrophosphate + all-trans-Decaprenyl diphosphate |
details
|
|
| GO Classification
|
| Biological Process |
| protein heterotetramerization |
| isoprenoid biosynthetic process |
| ubiquinone biosynthetic process |
| Cellular Component |
| mitochondrion |
| Molecular Function |
| metal ion binding |
| protein heterodimerization activity |
| trans-hexaprenyltranstransferase activity |
| trans-octaprenyltranstransferase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 10 |
| Locus
| 10p12.1 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 46260.6 |
| Theoretical pI
| 9.0 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|50659086|ref|NP_055132.2| decaprenyl-diphosphate synthase subunit 1 [Homo sapiens]
MASRWWRWRRGCSWKPAARSPGPGSPGRAGPLGPSAAAEVRAQVHRRKGLDLSQIPYINL
VKHLTSACPN
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q5T2R2 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:17759 |
| References |
| General References
| Not Available |