| Identification |
| HMDB Protein ID
| HMDBP11715 |
| Secondary Accession Numbers
| None |
| Name
| DNA polymerase delta subunit 2 |
| Synonyms
|
- DNA polymerase delta subunit p50
|
| Gene Name
| POLD2 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| The function of the small subunit is not yet clear.
|
| Pathways
|
- Base excision repair
- DNA replication
- Homologous recombination
- Human T-cell leukemia virus 1 infection
- Mismatch repair
- Nucleotide excision repair
- Purine metabolism
- Pyrimidine metabolism
|
| Reactions
|
| Deoxynucleoside triphosphate + DNA(n) → Pyrophosphate + DNA(n+1) |
details
|
| Deoxyadenosine triphosphate + DNA → Pyrophosphate + DNA |
details
|
| dGTP + DNA → Pyrophosphate + DNA |
details
|
| dCTP + DNA → Pyrophosphate + DNA |
details
|
| Thymidine 5'-triphosphate + DNA → Pyrophosphate + DNA |
details
|
|
| GO Classification
|
| Biological Process |
| base-excision repair |
| S phase of mitotic cell cycle |
| telomere maintenance via recombination |
| telomere maintenance via semi-conservative replication |
| nucleotide-excision repair, DNA gap filling |
| transcription-coupled nucleotide-excision repair |
| DNA strand elongation involved in DNA replication |
| Cellular Component |
| nucleoplasm |
| Molecular Function |
| DNA binding |
| DNA-directed DNA polymerase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 7 |
| Locus
| 7p13 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 51289.0 |
| Theoretical pI
| 5.576 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|187828568|ref|NP_001120690.1| DNA polymerase delta subunit 2 isoform 1 [Homo sapiens]
MFSEQAAQRAHTLLSPPSANNATFARVPVATYTNSSQPFRLGERSFSRQYAHIYATRLIQ
MRPFLENRAQ
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| P49005 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:9176 |
| References |
| General References
| Not Available |