| Identification |
| HMDB Protein ID
| HMDBP11712 |
| Secondary Accession Numbers
| None |
| Name
| Diphthine--ammonia ligase |
| Synonyms
|
- ATP-binding domain-containing protein 4
- Diphthamide synthase
- Diphthamide synthetase
|
| Gene Name
| ATPBD4 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Amidase that catalyzes the last step of diphthamide biosynthesis using ammonium and ATP. Diphthamide biosynthesis consists in the conversion of an L-histidine residue in the translation elongation factor eEF-2 (EEF2) to diphthamide (Probable).
|
| Pathways
|
- peptidyl-diphthamide biosynthesis
|
| Reactions
|
| Adenosine triphosphate + Diphthine + Ammonia → ADP + Phosphate + Diphthamide |
details
|
|
| GO Classification
|
Not Available
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 15 |
| Locus
| 15q14 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 18657.27 |
| Theoretical pI
| 6.409 |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|213972615|ref|NP_001135444.1| diphthine--ammonia ligase isoform 2 [Homo sapiens]
MRVAALISGGKDSCYNMMQCIAAGHQIVALANLRPAENQVGSDELDSYMYQTVGHHAIDL
YAEAMALPLY
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q7L8W6 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:30543 |
| References |
| General References
| Not Available |