| Identification |
| HMDB Protein ID
| HMDBP11711 |
| Secondary Accession Numbers
| None |
| Name
| 2'-deoxynucleoside 5'-phosphate N-hydrolase 1 |
| Synonyms
|
- c-Myc-responsive protein Rcl
|
| Gene Name
| DNPH1 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Catalyzes the cleavage of the N-glycosidic bond of deoxyribonucleoside 5'-monophosphates to yield deoxyribose 5-phosphate and a purine or pyrimidine base. Deoxyribonucleoside 5'-monophosphates containing purine bases are preferred to those containing pyrimidine bases (By similarity).
|
| Pathways
|
Not Available
|
| Reactions
|
| A deoxyribonucleoside 5'-monophosphate + H(2)0 → Deoxyribose 5-monophosphate + a purine or pyrimidine base |
details
|
|
| GO Classification
|
| Biological Process |
| nucleotide metabolic process |
| cell proliferation |
| positive regulation of cell growth |
| deoxyribonucleoside monophosphate catabolic process |
| Cellular Component |
| cytoplasm |
| nucleus |
| Molecular Function |
| deoxyribonucleoside 5'-monophosphate N-glycosidase activity |
| nucleoside deoxyribosyltransferase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 6 |
| Locus
| 6p21.1 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 19108.255 |
| Theoretical pI
| 5.037 |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|5454002|ref|NP_006434.1| 2'-deoxynucleoside 5'-phosphate N-hydrolase 1 isoform 1 [Homo sapiens]
MAAAMVPGRSESWERGEPGRPALYFCGSIRGGREDRTLYERIVSRLRRFGTVLTEHVAAA
ELGARGEEAA
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| O43598 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:21218 |
| References |
| General References
| Not Available |