| Identification |
| HMDB Protein ID
| HMDBP11707 |
| Secondary Accession Numbers
| None |
| Name
| ATP-dependent RNA helicase A |
| Synonyms
|
- RHA
- DEAH box protein 9
- Leukophysin
- Nuclear DNA helicase II
- LKP
- NDH II
|
| Gene Name
| DHX9 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Unwinds double-stranded DNA and RNA in a 3' to 5' direction. Alteration of secondary structure may subsequently influence interactions with proteins or other nucleic acids. Functions as a transcriptional activator. Component of the CRD-mediated complex that promotes MYC mRNA stability. Involved with LARP6 in the stabilization of type I collagen mRNAs for CO1A1 and CO1A2.
|
| Pathways
|
Not Available
|
| Reactions
|
| Adenosine triphosphate + Water → ADP + Phosphate |
details
|
|
| GO Classification
|
| Biological Process |
| mRNA splicing, via spliceosome |
| cellular response to heat |
| CRD-mediated mRNA stabilization |
| Cellular Component |
| nucleolus |
| nucleoplasm |
| centrosome |
| CRD-mediated mRNA stability complex |
| ribonucleoprotein complex |
| Molecular Function |
| ATP binding |
| DNA binding |
| ATP-dependent DNA helicase activity |
| ATP-dependent RNA helicase activity |
| double-stranded RNA binding |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 1 |
| Locus
| 1q25 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 140957.465 |
| Theoretical pI
| 6.843 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|100913206|ref|NP_001348.2| ATP-dependent RNA helicase A [Homo sapiens]
MGDVKNFLYAWCGKRKMTPSYEIRAVGNKNRQKFMCEVQVEGYNYTGMGNSTNKKDAQSN
AARDFVNYLV
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q08211 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:2750 |
| References |
| General References
| Not Available |