| Identification |
| HMDB Protein ID
| HMDBP11706 |
| Secondary Accession Numbers
| None |
| Name
| ATP-dependent RNA helicase DHX8 |
| Synonyms
|
- DEAH box protein 8
- RNA helicase HRH1
|
| Gene Name
| DHX8 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Facilitates nuclear export of spliced mRNA by releasing the RNA from the spliceosome.
|
| Pathways
|
|
| Reactions
|
| Adenosine triphosphate + Water → ADP + Phosphate |
details
|
|
| GO Classification
|
| Biological Process |
| mRNA splicing, via spliceosome |
| Cellular Component |
| catalytic step 2 spliceosome |
| Molecular Function |
| ATP binding |
| RNA binding |
| ATP-dependent RNA helicase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 17 |
| Locus
| 17q21.31 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 139313.305 |
| Theoretical pI
| 8.328 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|4826690|ref|NP_004932.1| ATP-dependent RNA helicase DHX8 [Homo sapiens]
MAVAVAMAGALIGSEPGPAEELAKLEYLSLVSKVCTELDNHLGINDKDLAEFVISLAEKN
TTFDTFKASL
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q14562 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:2749 |
| References |
| General References
| Not Available |