| Identification |
| HMDB Protein ID
| HMDBP11701 |
| Secondary Accession Numbers
| None |
| Name
| Probable ATP-dependent RNA helicase DHX36 |
| Synonyms
|
- DEAH box protein 36
- MLE-like protein 1
- RNA helicase associated with AU-rich element ARE
|
| Gene Name
| DHX36 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Plays a role in degradation and deadenylation of mRNAs containing in their 3'-UTR the consensus ARE sequence element. May function in sex development and spermatogenesis.
|
| Pathways
|
|
| Reactions
|
| Adenosine triphosphate + Water → ADP + Phosphate |
details
|
|
| GO Classification
|
| Biological Process |
| response to virus |
| response to exogenous dsRNA |
| Cellular Component |
| cytoplasm |
| nucleus |
| Molecular Function |
| ATP binding |
| ATP-dependent helicase activity |
| double-stranded RNA binding |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 3 |
| Locus
| 3q25.2 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 113152.305 |
| Theoretical pI
| 7.667 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|167830436|ref|NP_001107869.1| probable ATP-dependent RNA helicase DHX36 isoform 2 [Homo sapiens]
MSYDYHQNWGRDGGPRSSGGGYGGGPAGGHGGNRGSGGGGGGGGGGRGGRGRHPGHLKGR
EIGMWYAKKQ
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9H2U1 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:14410 |
| References |
| General References
| Not Available |