| Identification |
| HMDB Protein ID
| HMDBP11698 |
| Secondary Accession Numbers
| None |
| Name
| Putative ATP-dependent RNA helicase DHX33 |
| Synonyms
|
- DEAH box protein 33
|
| Gene Name
| DHX33 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Stimulates RNA polymerase I transcription of the 47S precursor rRNA. Associates with ribosomal DNA (rDNA) loci where it is involved in POLR1A recruitment. Important element of nucleolar organization.
|
| Pathways
|
Not Available
|
| Reactions
|
| Adenosine triphosphate + Water → ADP + Phosphate |
details
|
|
| GO Classification
|
| Biological Process |
| positive regulation of transcription from RNA polymerase I promoter |
| Cellular Component |
| nucleolus |
| nucleoplasm |
| Molecular Function |
| ATP binding |
| ATP-dependent helicase activity |
| rDNA binding |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 17 |
| Locus
| 17p13.2 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 60392.585 |
| Theoretical pI
| 8.345 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|315113911|ref|NP_001186628.1| putative ATP-dependent RNA helicase DHX33 isoform 2 [Homo sapiens]
MLLREAISDSLLRKYSCVILDEAHERTIHTDVLFGVVKAAQKRRKELGKLPLKVIVMSAT
MDVDLFSQYF
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9H6R0 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:16718 |
| References |
| General References
| Not Available |