Hmdb loader
Identification
HMDB Protein ID HMDBP11690
Secondary Accession Numbers None
Name Probable ATP-dependent RNA helicase DDX5
Synonyms
  1. DEAD box protein 5
  2. RNA helicase p68
Gene Name DDX5
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Involved in the alternative regulation of pre-mRNA splicing; its RNA helicase activity is necessary for increasing tau exon 10 inclusion and occurs in a RBM4-dependent manner. Binds to the tau pre-mRNA in the stem-loop region downstream of exon 10. The rate of ATP hydrolysis is highly stimulated by single-stranded RNA. Involved in transcriptional regulation; the function is independent of the RNA helicase activity. Transcriptional coactivator for estrogen receptor ESR1 and androgen receptor AR. Increases ESR1 AF-1 domain-mediated transactivation and ESR1 AF-1 and AF-2 domains transcriptional synergistic activity. Synergizes with DDX17 and SRA1 RNA to activate MYOD1 transcriptional activity and involved in skeletal muscle differentiation. Transcriptional coactivator for p53/TP53 and involved in p53/TP53 transcriptional response to DNA damage and p53/TP53-dependent apoptosis. Transcriptional coactivator for RUNX2 and involved in regulation of osteoblast differentiation. Acts as transcriptional repressor in a promoter-specicic manner; the function probbaly involves association with histone deacetylases, such as HDAC1.
Pathways
  • Proteoglycans in cancer
  • Spliceosome
  • Transcriptional misregulation in cancer
Reactions
Adenosine triphosphate + Water → ADP + Phosphate details
GO Classification
Biological Process
regulation of skeletal muscle cell differentiation
regulation of viral genome replication
regulation of osteoblast differentiation
regulation of alternative mRNA splicing, via spliceosome
positive regulation of DNA damage response, signal transduction by p53 class mediator
intrinsic apoptotic signaling pathway by p53 class mediator
cell growth
mRNA splicing, via spliceosome
positive regulation of intracellular estrogen receptor signaling pathway
positive regulation of transcription from RNA polymerase II promoter
negative regulation of transcription from RNA polymerase II promoter
regulation of androgen receptor signaling pathway
in utero embryonic development
transcription, DNA-dependent
Cellular Component
catalytic step 2 spliceosome
nucleolus
Molecular Function
RNA helicase activity
ATP binding
ATP-dependent RNA helicase activity
androgen receptor binding
pre-mRNA binding
transcription coactivator activity
estrogen receptor binding
Cellular Location Not Available
Gene Properties
Chromosome Location 17
Locus 17q21
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 69147.585
Theoretical pI 8.924
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|4758138|ref|NP_004387.1| probable ATP-dependent RNA helicase DDX5 [Homo sapiens]
MSGYSSDRDRGRDRGFGAPRFGGSRAGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFYQ
EHPDLARRTA
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P17844
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:2746
References
General References Not Available