| Identification |
| HMDB Protein ID
| HMDBP11685 |
| Secondary Accession Numbers
| None |
| Name
| ATP-dependent RNA helicase DDX54 |
| Synonyms
|
- ATP-dependent RNA helicase DP97
- DEAD box RNA helicase 97 kDa
- DEAD box protein 54
|
| Gene Name
| DDX54 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Has RNA-dependent ATPase activity. Represses the transcriptional activity of nuclear receptors.
|
| Pathways
|
Not Available
|
| Reactions
|
| Adenosine triphosphate + Water → ADP + Phosphate |
details
|
|
| GO Classification
|
| Biological Process |
| regulation of transcription, DNA-dependent |
| transcription, DNA-dependent |
| RNA processing |
| intracellular estrogen receptor signaling pathway |
| Cellular Component |
| nucleolus |
| Molecular Function |
| ATP binding |
| RNA binding |
| estrogen receptor binding |
| transcription corepressor activity |
| ATP-dependent RNA helicase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 12 |
| Locus
| 12q24.13 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 98665.065 |
| Theoretical pI
| 10.025 |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|164419743|ref|NP_001104792.1| ATP-dependent RNA helicase DDX54 isoform 1 [Homo sapiens]
MAADKGPAAGPRSRAAMAQWRKKKGLRKRRGAASQARGSDSEDGEFEIQAEDDARARKLG
PGRPLPTFPT
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q8TDD1 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:20084 |
| References |
| General References
| Not Available |