| Identification |
| HMDB Protein ID
| HMDBP11674 |
| Secondary Accession Numbers
| None |
| Name
| Probable ATP-dependent RNA helicase DDX41 |
| Synonyms
|
- DEAD box protein 41
- DEAD box protein abstrakt homolog
|
| Gene Name
| DDX41 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Probable ATP-dependent RNA helicase. Is required during post-transcriptional gene expression. May be involved in pre-mRNA splicing.
|
| Pathways
|
Not Available
|
| Reactions
|
| Adenosine triphosphate + Water → ADP + Phosphate |
details
|
|
| GO Classification
|
| Biological Process |
| defense response to virus |
| multicellular organismal development |
| apoptotic process |
| positive regulation of transcription from RNA polymerase II promoter |
| cellular response to interferon-beta |
| mRNA splicing, via spliceosome |
| Cellular Component |
| endoplasmic reticulum |
| catalytic step 2 spliceosome |
| Molecular Function |
| metal ion binding |
| ATP binding |
| zinc ion binding |
| RNA binding |
| DNA binding |
| ATP-dependent helicase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 5 |
| Locus
| 5q35.3 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 69837.015 |
| Theoretical pI
| 6.84 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|21071032|ref|NP_057306.2| probable ATP-dependent RNA helicase DDX41 [Homo sapiens]
MEESEPERKRARTDEVPAGGSRSEAEDEDDEDYVPYVPLRQRRQLLLQKLLQRRRKGAAE
EEQQDSGSEP
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9UJV9 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:18674 |
| References |
| General References
| Not Available |