| Identification |
| HMDB Protein ID
| HMDBP11664 |
| Secondary Accession Numbers
| None |
| Name
| Probable ATP-dependent RNA helicase DDX20 |
| Synonyms
|
- Component of gems 3
- DEAD box protein 20
- DEAD box protein DP 103
- Gemin-3
|
| Gene Name
| DDX20 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| The SMN complex plays an essential role in spliceosomal snRNP assembly in the cytoplasm and is required for pre-mRNA splicing in the nucleus. It may also play a role in the metabolism of snoRNPs.
|
| Pathways
|
- Nucleocytoplasmic transport
|
| Reactions
|
| Adenosine triphosphate + Water → ADP + Phosphate |
details
|
|
| GO Classification
|
| Biological Process |
| positive regulation of apoptotic process |
| induction of apoptosis |
| ncRNA metabolic process |
| negative regulation of transcription from RNA polymerase II promoter |
| assembly of spliceosomal tri-snRNP |
| Cellular Component |
| cytosol |
| cytoskeleton |
| nucleoplasm |
| Cajal body |
| spliceosomal complex |
| transcriptional repressor complex |
| Molecular Function |
| ATP binding |
| DNA binding |
| ATP-dependent RNA helicase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 1 |
| Locus
| 1p21.1-p13.2 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 92239.715 |
| Theoretical pI
| 6.952 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|256223453|ref|NP_009135.4| probable ATP-dependent RNA helicase DDX20 [Homo sapiens]
MAAAFEASGALAAVATAMPAEHVAVQVPAPEPTPGPVRILRTAQDLSSPRTRTGDVLLAE
PADFESLLLS
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9UHI6 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:2743 |
| References |
| General References
| Not Available |