| Identification |
| HMDB Protein ID
| HMDBP11652 |
| Secondary Accession Numbers
| None |
| Name
| Choline transporter-like protein 5 |
| Synonyms
|
- Solute carrier family 44 member 5
|
| Gene Name
| SLC44A5 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Not Available |
| Pathways
|
Not Available
|
| Reactions
| Not Available |
| GO Classification
|
| Biological Process |
| transmembrane transport |
| phosphatidylcholine biosynthetic process |
| Cellular Component |
| integral to membrane |
| plasma membrane |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 1 |
| Locus
| 1p31.1 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 81561.09 |
| Theoretical pI
| 8.057 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|194239633|ref|NP_001123530.1| choline transporter-like protein 5 isoform B [Homo sapiens]
MNDTEKPADTPSEEEDFGDPRTYDPDFKGPVANRSCTDVLCCMIFLLCIIGYIVLGLVAW
VHGDPRRAAY
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q8NCS7 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:28524 |
| References |
| General References
| Not Available |