| Identification |
| HMDB Protein ID
| HMDBP11650 |
| Secondary Accession Numbers
| None |
| Name
| Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 2 |
| Synonyms
|
- Nuclear LIM interactor-interacting factor 2
- Protein OS-4
- Small C-terminal domain phosphatase 2
- Small CTD phosphatase 2
- NLI-interacting factor 2
- SCP2
|
| Gene Name
| CTDSP2 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Preferentially catalyzes the dephosphorylation of 'Ser-5' within the tandem 7 residues repeats in the C-terminal domain (CTD) of the largest RNA polymerase II subunit POLR2A. Negatively regulates RNA polymerase II transcription, possibly by controlling the transition from initiation/capping to processive transcript elongation. Recruited by REST to neuronal genes that contain RE-1 elements, leading to neuronal gene silencing in non-neuronal cells. May contribute to the development of sarcomas.
|
| Pathways
|
Not Available
|
| Reactions
|
| A phosphoprotein + Water → a protein + Phosphate |
details
|
|
| GO Classification
|
| Biological Process |
| activation of signaling protein activity involved in unfolded protein response |
| protein dephosphorylation |
| Cellular Component |
| nucleoplasm |
| Molecular Function |
| metal ion binding |
| CTD phosphatase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 12 |
| Locus
| 12q14.1 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 30663.73 |
| Theoretical pI
| 5.524 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|93004102|ref|NP_005721.3| carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 2 [Homo sapiens]
MEHGSIITQARREDALVLTKQGLVSKSSPKKPRGRNIFKALFCCFRAQHVGQSSSSTELA
AYKEEANTIA
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| O14595 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:17077 |
| References |
| General References
| Not Available |