| Identification |
| HMDB Protein ID
| HMDBP11648 |
| Secondary Accession Numbers
| None |
| Name
| Steroid 21-hydroxylase |
| Synonyms
|
- 21-OHase
- Cytochrome P-450c21
- Cytochrome P450 21
- Cytochrome P450 XXI
- Cytochrome P450-C21
- Cytochrome P450-C21B
|
| Gene Name
| CYP21A2 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Specifically catalyzes the 21-hydroxylation of steroids. Required for the adrenal synthesis of mineralocorticoids and glucocorticoids.
|
| Pathways
|
- 11-beta-hydroxylase deficiency (CYP11B1)
- 17-alpha-hydroxylase deficiency (CYP17)
- 21-hydroxylase deficiency (CYP21)
- 3-Beta-Hydroxysteroid Dehydrogenase Deficiency
- Adrenal Hyperplasia Type 3 or Congenital Adrenal Hyperplasia due to 21-hydroxylase Deficiency
- Adrenal Hyperplasia Type 5 or Congenital Adrenal Hyperplasia due to 17 Alpha-hydroxylase Deficiency
- Apparent mineralocorticoid excess syndrome
- Congenital Lipoid Adrenal Hyperplasia (CLAH) or Lipoid CAH
- Corticosterone methyl oxidase I deficiency (CMO I)
- Corticosterone methyl oxidase II deficiency - CMO II
- Steroid hormone biosynthesis
- Steroidogenesis
|
| Reactions
|
| A steroid + AH(2) + Oxygen → a 21-hydroxysteroid + A + Water |
details
|
| Progesterone + Reduced acceptor + Oxygen → Deoxycorticosterone + Acceptor + Water |
details
|
| 21-Deoxycortisol + Reduced acceptor + Oxygen → Cortisol + Acceptor + Water |
details
|
| 17-Hydroxyprogesterone + Reduced acceptor + Oxygen → Cortexolone + Acceptor + Water |
details
|
| Pregnenolone + Reduced acceptor + Oxygen → 21-Hydroxypregnenolone + Acceptor + Water |
details
|
| 11beta-Hydroxyprogesterone + Reduced acceptor + Oxygen → Corticosterone + Acceptor + Water |
details
|
| 17a-Hydroxypregnenolone + NADPH + Hydrogen Ion + Oxygen → 17alpha,21-Dihydroxypregnenolone + NADP + Water |
details
|
|
| GO Classification
|
| Biological Process |
| glucocorticoid biosynthetic process |
| mineralocorticoid biosynthetic process |
| small molecule metabolic process |
| xenobiotic metabolic process |
| Cellular Component |
| endoplasmic reticulum membrane |
| Molecular Function |
| electron carrier activity |
| iron ion binding |
| steroid binding |
| heme binding |
| steroid hydroxylase activity |
| steroid 21-monooxygenase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 6 |
| Locus
| 6p21.3 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 56000.94 |
| Theoretical pI
| 7.818 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|323510663|ref|NP_000491.4| steroid 21-hydroxylase isoform a [Homo sapiens]
MLLLGLLLLLPLLAGARLLWNWWKLRSLHLPPLAPGFLHLLQPDLPIYLLGLTQKFGPIY
RLHLGLQDVV
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| P08686 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:2600 |
| References |
| General References
| Not Available |