| Identification |
| HMDB Protein ID
| HMDBP11627 |
| Secondary Accession Numbers
| None |
| Name
| Alpha-tubulin N-acetyltransferase |
| Synonyms
|
- Alpha-TAT
- TAT
- Acetyltransferase mec-17 homolog
|
| Gene Name
| ATAT1 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Specifically acetylates 'Lys-40' in alpha-tubulin on the lumenal side of microtubules. May affect microtubule stability and regulate microtubule dynamics. May be involved in neuron development.
|
| Pathways
|
Not Available
|
| Reactions
|
| Acetyl-CoA + [alpha-tubulin]-L-lysine → Coenzyme A + [alpha-tubulin]-N(6)-acetyl-L-lysine |
details
|
|
| GO Classification
|
| Molecular Function |
| tubulin N-acetyltransferase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 6 |
| Locus
| 6p21.33 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 45573.35 |
| Theoretical pI
| 9.69 |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|72534730|ref|NP_001026892.1| alpha-tubulin N-acetyltransferase isoform 1 precursor [Homo sapiens]
MWLTWPFCFLTITLREEGVCHLESVDLQQQIMTIIDELGKASAKAQNLSAPITSASRMQS
NRHVVYILKD
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q5SQI0 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:21186 |
| References |
| General References
| Not Available |