| Identification |
| HMDB Protein ID
| HMDBP11619 |
| Secondary Accession Numbers
| None |
| Name
| Activating signal cointegrator 1 complex subunit 3 |
| Synonyms
|
- ASC-1 complex subunit p200
- Helicase, ATP binding 1
- Trip4 complex subunit p200
- ASC1p200
|
| Gene Name
| ASCC3 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| 3'-5' DNA helicase involved in repair of alkylated DNA. Promotes DNA unwinding to generate single-stranded substrate needed for ALKHB3, enabling ALKHB3 to process alkylated N3-methylcytosine (3mC) within double-stranded regions. Enhances NF-kappa-B, SRF and AP1 transactivation.
|
| Pathways
|
Not Available
|
| Reactions
|
| Adenosine triphosphate + Water → ADP + Phosphate |
details
|
|
| GO Classification
|
| Biological Process |
| regulation of transcription, DNA-dependent |
| transcription, DNA-dependent |
| cell proliferation |
| DNA dealkylation involved in DNA repair |
| Cellular Component |
| cytoplasm |
| nucleus |
| Molecular Function |
| ATP binding |
| ATP-dependent 3'-5' DNA helicase activity |
| nucleic acid binding |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 6 |
| Locus
| 6q16 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 251458.205 |
| Theoretical pI
| 7.099 |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|76880486|ref|NP_006819.2| activating signal cointegrator 1 complex subunit 3 isoform a [Homo sapiens]
MALPRLTGALRSFSNVTKQDNYNEEVADLKIKRSKLHEQVLDLGLTWKKIIKFLNEKLEK
SKMQSINEDL
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q8N3C0 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:18697 |
| References |
| General References
| Not Available |