Hmdb loader
Identification
HMDB Protein ID HMDBP11617
Secondary Accession Numbers None
Name Protein arginine N-methyltransferase 7
Synonyms
  1. Histone-arginine N-methyltransferase PRMT7
  2. [Myelin basic protein]-arginine N-methyltransferase PRMT7
Gene Name PRMT7
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Arginine methyltransferase that can both catalyze the formation of omega-N monomethylarginine (MMA) and symmetrical dimethylarginine (sDMA), with a preference for the formation of MMA. Specifically mediates the symmetrical dimethylation of arginine residues in the small nuclear ribonucleoproteins Sm D1 (SNRPD1) and Sm D3 (SNRPD3); such methylation being required for the assembly and biogenesis of snRNP core particles. Specifically mediates the symmetric dimethylation of histone H4 'Arg-3' to form H4R3me2s. Plays a role in gene imprinting by being recruited by CTCFL at the H19 imprinted control region (ICR) and methylating histone H4 to form H4R3me2s, possibly leading to recruit DNA methyltransferases at these sites. May also play a role in embryonic stem cell (ESC) pluripotency. Also able to mediate the arginine methylation of histone H2A and myelin basic protein (MBP) in vitro; the relevance of such results is however unclear in vivo.
Pathways Not Available
Reactions
S-Adenosylmethionine + arginine-[histone] → S-Adenosylhomocysteine + N(omega)-methyl-arginine-[histone] details
S-Adenosylmethionine + [myelin basic protein]-arginine → S-Adenosylhomocysteine + [myelin basic protein]-N(omega)-methyl-arginine details
GO Classification
Biological Process
cell differentiation
regulation of transcription, DNA-dependent
transcription, DNA-dependent
spliceosomal snRNP assembly
DNA methylation involved in gamete generation
regulation of gene expression by genetic imprinting
regulation of protein binding
Cellular Component
cytosol
nucleus
Molecular Function
histone methyltransferase activity (H4-R3 specific)
protein-arginine omega-N symmetric methyltransferase activity
ribonucleoprotein complex binding
histone binding
protein-arginine omega-N monomethyltransferase activity
[myelin basic protein]-arginine N-methyltransferase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 16
Locus 16q22.1
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 73153.495
Theoretical pI 5.457
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|296317343|ref|NP_001171753.1| protein arginine N-methyltransferase 7 isoform 2 [Homo sapiens]
MKIFCSRANPTTGSVEWLEEDEHYDYHQEIARSSYADMLHDKDRVFKPMADAAVKIVEKN
GFSDKIKVIN
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9NVM4
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:25557
References
General References Not Available