| Identification |
| HMDB Protein ID
| HMDBP11615 |
| Secondary Accession Numbers
| None |
| Name
| Protein arginine N-methyltransferase 2 |
| Synonyms
|
- Histone-arginine N-methyltransferase PRMT2
|
| Gene Name
| PRMT2 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Arginine methyltransferase that methylates the guanidino nitrogens of arginyl residues in proteins such as STAT3, FBL, histone H4. Acts as a coactivator (with NCOA2) of the androgen receptor (AR)-mediated transactivation. Acts as a coactivator (with estrogen) of estrogen receptor (ER)-mediated transactivation. Enhances PGR, PPARG, RARA-mediated transactivation. May inhibit NF-kappa-B transcription and promote apoptosis. Represses E2F1 transcriptional activity (in a RB1-dependent manner). May be involved in growth regulation.
|
| Pathways
|
Not Available
|
| Reactions
|
| S-Adenosylmethionine + arginine-[histone] → S-Adenosylhomocysteine + N(omega)-methyl-arginine-[histone] |
details
|
|
| GO Classification
|
| Biological Process |
| developmental cell growth |
| induction of apoptosis |
| negative regulation of G1/S transition of mitotic cell cycle |
| negative regulation of NF-kappaB transcription factor activity |
| negative regulation of transcription, DNA-dependent |
| positive regulation of transcription, DNA-dependent |
| regulation of androgen receptor signaling pathway |
| Cellular Component |
| cytosol |
| nucleus |
| Molecular Function |
| estrogen receptor binding |
| histone-arginine N-methyltransferase activity |
| signal transducer activity |
| transcription coactivator activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 21 |
| Locus
| 21q22.3 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 37166.79 |
| Theoretical pI
| 5.235 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|338968840|ref|NP_001229793.1| protein arginine N-methyltransferase 2 isoform 2 [Homo sapiens]
MATSGDCPRSESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILIL
RQTTADWWWG
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| P55345 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:5186 |
| References |
| General References
| Not Available |