| Identification |
| HMDB Protein ID
| HMDBP11613 |
| Secondary Accession Numbers
| None |
| Name
| Alkylglycerol monooxygenase |
| Synonyms
|
- Transmembrane protein 195
|
| Gene Name
| AGMO |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Glyceryl-ether monooxygenase that cleaves the O-alkyl bond of ether lipids. Ether lipids are essential components of brain membranes.
|
| Pathways
|
Not Available
|
| Reactions
|
| 1-alkyl-sn-glycerol + Sapropterin + Oxygen → 1-O-alkyl-sn-glycerol + Dihydrobiopterin + Water |
details
|
|
| GO Classification
|
| Biological Process |
| fatty acid biosynthetic process |
| ether lipid metabolic process |
| membrane lipid metabolic process |
| Cellular Component |
| integral to membrane |
| endoplasmic reticulum membrane |
| endoplasmic reticulum |
| Molecular Function |
| iron ion binding |
| glyceryl-ether monooxygenase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 7 |
| Locus
| 7p21.2 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 51499.41 |
| Theoretical pI
| 7.919 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|51972212|ref|NP_001004320.1| alkylglycerol monooxygenase [Homo sapiens]
MKNPEAQQDVSVSQGFRMLFYTMKPSETSFQTLEEVPDYVKKATPFFISLMLLELVVSWI
LKGKPPGRLD
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q6ZNB7 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:33784 |
| References |
| General References
| Not Available |