| Identification |
| HMDB Protein ID
| HMDBP11612 |
| Secondary Accession Numbers
| None |
| Name
| Alkylated DNA repair protein alkB homolog 8 |
| Synonyms
|
- Probable alpha-ketoglutarate-dependent dioxygenase ABH8
- S-adenosyl-L-methionine-dependent tRNA methyltransferase ABH8
- tRNA (carboxymethyluridine(34)-5-O)-methyltransferase ABH8
|
| Gene Name
| ALKBH8 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Catalyzes the methylation of 5-carboxymethyl uridine to 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in tRNA. Catalyzes the last step in the formation of 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in target tRNA. Has a preference for tRNA(Arg) and tRNA(Glu), and does not bind tRNA(Lys). Required for normal survival after DNA damage. May inhibit apoptosis and promote cell survival and angiogenesis.
|
| Pathways
|
Not Available
|
| Reactions
|
| S-Adenosylmethionine + carboxymethyluridine(34) in tRNA → S-Adenosylhomocysteine + 5-(2-methoxy-2-oxoethyl)uridine(34) in tRNA |
details
|
|
| GO Classification
|
| Biological Process |
| response to DNA damage stimulus |
| Cellular Component |
| cytosol |
| nucleus |
| microtubule cytoskeleton |
| Molecular Function |
| metal ion binding |
| RNA binding |
| oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors |
| tRNA (uracil) methyltransferase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 11 |
| Locus
| 11q22.3 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 75207.875 |
| Theoretical pI
| 7.987 |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|195927056|ref|NP_620130.2| alkylated DNA repair protein alkB homolog 8 [Homo sapiens]
MDSNHQSNYKLSKTEKKFLRKQIKAKHTLLRHEGIETVSYATQSLVVANGGLGNGVSRNQ
LLPVLEKCGL
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q96BT7 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:25189 |
| References |
| General References
| Not Available |