| Identification |
| HMDB Protein ID
| HMDBP11605 |
| Secondary Accession Numbers
| None |
| Name
| Activation-induced cytidine deaminase |
| Synonyms
|
- Cytidine aminohydrolase
|
| Gene Name
| AICDA |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Single-stranded DNA-specific cytidine deaminase. Involved in somatic hypermutation, gene conversion, and class-switch recombination in B-lymphocytes. Required for several crucial steps of B-cell terminal differentiation necessary for efficient antibody responses. May also play a role in the epigenetic regulation of gene expression by participating in DNA demethylation.
|
| Pathways
|
- Intestinal immune network for IgA production
- Primary immunodeficiency
|
| Reactions
|
| Cytidine + Water → Uridine + Ammonia |
details
|
|
| GO Classification
|
| Biological Process |
| DNA demethylation |
| B cell differentiation |
| cellular response to lipopolysaccharide |
| isotype switching |
| mRNA processing |
| negative regulation of methylation-dependent chromatin silencing |
| somatic diversification of immunoglobulins |
| Cellular Component |
| cytoplasm |
| nucleus |
| Molecular Function |
| metal ion binding |
| cytidine deaminase activity |
| zinc ion binding |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 12 |
| Locus
| 12p13 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 23953.265 |
| Theoretical pI
| 9.394 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|10190700|ref|NP_065712.1| activation-induced cytidine deaminase [Homo sapiens]
MDSLLMNRRKFLYQFKNVRWAKGRRETYLCYVVKRRDSATSFSLDFGYLRNKNGCHVELL
FLRYISDWDL
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9GZX7 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:13203 |
| References |
| General References
| Not Available |