| Identification |
| HMDB Protein ID
| HMDBP11604 |
| Secondary Accession Numbers
| None |
| Name
| Hydroxylysine kinase |
| Synonyms
|
- 5-hydroxy-L-lysine kinase
- Aminoglycoside phosphotransferase domain-containing protein 1
|
| Gene Name
| AGPHD1 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Catalyzes the GTP-dependent phosphorylation of 5-hydroxy-L-lysine.
|
| Pathways
|
Not Available
|
| Reactions
|
| Guanosine triphosphate + 5-Hydroxylysine → Guanosine diphosphate + 5-phosphonooxy-L-lysine |
details
|
|
| GO Classification
|
| Cellular Component |
| cytoplasm |
| Molecular Function |
| hydroxylysine kinase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 15 |
| Locus
| 15q25.1 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 41932.82 |
| Theoretical pI
| 6.843 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|134288871|ref|NP_001013641.2| hydroxylysine kinase isoform 1 [Homo sapiens]
MSSGNYQQSEALSKPTFSEEQASALVESVFGLKVSKVRPLPSYDDQNFHVYVSKTKDGPT
EYVLKISNTK
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| A2RU49 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:34403 |
| References |
| General References
| Not Available |